SCOPe 2.04: Domain d3ncwb1: 3ncw B:752-840

Lineage for d3ncwb1 (3ncw B:752-840)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.0: automated matches [231720] (1 protein)
   not a true family

6. Protein automated matches [231721] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries)

8. Domain d3ncwb1: 3ncw B:752-840 [247879]
   Other proteins in same PDB: d3ncwa2, d3ncwb2, d3ncwc2, d3ncwd2
   automated match to d2zqka1

Details for d3ncwb1

PDB Entry: 3ncw, 2.8 Å

PDB Description: Crystal structure of EHEC O157:H7 intimin

PDB Compounds: (B:) Intimin adherence protein

SCOPe Domain Sequences for d3ncwb1:

Sequence; same for both SEQRES and ATOM records:

>d3ncwb1 b.1.14.0 (B:752-840) automated matches {Escherichia coli [TaxId: 544404]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps

Timeline for d3ncwb1:

• d3ncwb1 is new in SCOPe 2.04-stable
  
• d3ncwb1 appears in SCOPe 2.05
  
• d3ncwb1 appears in the current release, SCOPe 2.08