Lineage for d3ncwa2 (3ncw A:841-934)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002321Species Escherichia coli [TaxId:544404] [233005] (2 PDB entries)
  8. 3002324Domain d3ncwa2: 3ncw A:841-934 [247878]
    Other proteins in same PDB: d3ncwa1, d3ncwb1, d3ncwc1, d3ncwd1
    automated match to d2zqka2

Details for d3ncwa2

PDB Entry: 3ncw (more details), 2.8 Å

PDB Description: Crystal structure of EHEC O157:H7 intimin
PDB Compounds: (A:) Intimin adherence protein

SCOPe Domain Sequences for d3ncwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncwa2 d.169.1.0 (A:841-934) automated matches {Escherichia coli [TaxId: 544404]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

SCOPe Domain Coordinates for d3ncwa2:

Click to download the PDB-style file with coordinates for d3ncwa2.
(The format of our PDB-style files is described here.)

Timeline for d3ncwa2: