Lineage for d1fcfa1 (1fcf A:77-252)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58787Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 58788Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 58789Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 58813Protein Photosystem II D1 C-terminal processing protease, PDZ domain [50170] (1 species)
  7. 58814Species Algae (Scenedesmus obliquus) [TaxId:3088] [50171] (4 PDB entries)
  8. 58818Domain d1fcfa1: 1fcf A:77-252 [24786]
    Other proteins in same PDB: d1fcfa2

Details for d1fcfa1

PDB Entry: 1fcf (more details), 2.1 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcfa1 b.36.1.1 (A:77-252) Photosystem II D1 C-terminal processing protease, PDZ domain {Algae (Scenedesmus obliquus)}
mvtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavl
ddpftrflepsrlaalrrgtagsvtgvgleitydggsgkdvvvltpapggpaekagarag
dvivtvdgtavkglslydvsdllqgeadsqvevvlhapgapsntrtlqltrqkvti

SCOP Domain Coordinates for d1fcfa1:

Click to download the PDB-style file with coordinates for d1fcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1fcfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcfa2