SCOPe 2.05: Domain d3n41f2: 3n41 F:293-381

Lineage for d3n41f2 (3n41 F:293-381)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Chikungunya virus [TaxId:37124] [226027] (5 PDB entries)

8. Domain d3n41f2: 3n41 F:293-381 [247854]
   Other proteins in same PDB: d3n41f1
   automated match to d3n40f2
   complexed with nag

Details for d3n41f2

PDB Entry: 3n41, 3.01 Å

PDB Description: crystal structure of the mature envelope glycoprotein complex (spontaneous cleavage) of chikungunya virus.

PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n41f2:

Sequence; same for both SEQRES and ATOM records:

>d3n41f2 b.1.18.0 (F:293-381) automated matches {Chikungunya virus [TaxId: 37124]}
apsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsql
qisfstalasaefrvqvcstqvhcaaech

Timeline for d3n41f2:

• d3n41f2 first appeared in SCOPe 2.04
  
• d3n41f2 appears in SCOPe 2.06
  
• d3n41f2 appears in the current release, SCOPe 2.08