Lineage for d3n41f1 (3n41 F:0-292)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696556Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1696557Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 1696558Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 1696590Protein automated matches [226969] (3 species)
    not a true protein
  7. 1696591Species Chikungunya virus [TaxId:37124] [226028] (3 PDB entries)
  8. 1696594Domain d3n41f1: 3n41 F:0-292 [247853]
    Other proteins in same PDB: d3n41f2
    automated match to d3n40f1
    complexed with nag

Details for d3n41f1

PDB Entry: 3n41 (more details), 3.01 Å

PDB Description: Crystal structure of the mature envelope glycoprotein complex (spontaneous cleavage) of Chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n41f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n41f1 f.10.1.1 (F:0-292) automated matches {Chikungunya virus [TaxId: 37124]}
gyehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspy
vkccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefa
sayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivv
ykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsg
fkywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

SCOPe Domain Coordinates for d3n41f1:

Click to download the PDB-style file with coordinates for d3n41f1.
(The format of our PDB-style files is described here.)

Timeline for d3n41f1: