Lineage for d3n3ia1 (3n3i A:1-99)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067878Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2068772Domain d3n3ia1: 3n3i A:1-99 [247851]
    automated match to d3mima_
    complexed with roc

Details for d3n3ia1

PDB Entry: 3n3i (more details), 2.5 Å

PDB Description: crystal structure of g48v/c95f tethered hiv-1 protease/saquinavir complex
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3n3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3ia1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigftlnf

SCOPe Domain Coordinates for d3n3ia1:

Click to download the PDB-style file with coordinates for d3n3ia1.
(The format of our PDB-style files is described here.)

Timeline for d3n3ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n3ia2