SCOPe 2.04: Domain d3n3bb_: 3n3b B:

Lineage for d3n3bb_ (3n3b B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255975] (6 PDB entries)

8. Domain d3n3bb_: 3n3b B: [247850]
   automated match to d1uzrb_
   complexed with fmn, mn, peo

Details for d3n3bb_

PDB Entry: 3n3b, 2.36 Å

PDB Description: Ribonucleotide Reductase Dimanganese(II)-NrdF from Escherichia coli in Complex with Reduced NrdI with a Trapped Peroxide

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 2 subunit beta

SCOPe Domain Sequences for d3n3bb_:

Sequence; same for both SEQRES and ATOM records:

>d3n3bb_ a.25.1.2 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt
lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw
seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl
irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet
pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp

Timeline for d3n3bb_:

• d3n3bb_ is new in SCOPe 2.04-stable
  
• d3n3bb_ appears in SCOPe 2.05
  
• d3n3bb_ appears in the current release, SCOPe 2.08