Lineage for d1fc6a1 (1fc6 A:78-252)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58787Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 58788Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 58789Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 58813Protein Photosystem II D1 C-terminal processing protease, PDZ domain [50170] (1 species)
  7. 58814Species Algae (Scenedesmus obliquus) [TaxId:3088] [50171] (4 PDB entries)
  8. 58815Domain d1fc6a1: 1fc6 A:78-252 [24783]
    Other proteins in same PDB: d1fc6a2

Details for d1fc6a1

PDB Entry: 1fc6 (more details), 1.8 Å

PDB Description: photosystem ii d1 c-terminal processing protease

SCOP Domain Sequences for d1fc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc6a1 b.36.1.1 (A:78-252) Photosystem II D1 C-terminal processing protease, PDZ domain {Algae (Scenedesmus obliquus)}
vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkmlavld
dpftrflepsrlaalrrgtagsvtgvgleitydggsgkdvvvltpapggpaekagaragd
vivtvdgtavkgmslydvsdllqgeadsqvevvlhapgapsntrtlqltrqkvti

SCOP Domain Coordinates for d1fc6a1:

Click to download the PDB-style file with coordinates for d1fc6a1.
(The format of our PDB-style files is described here.)

Timeline for d1fc6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc6a2