Lineage for d1b8qa_ (1b8q A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13490Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 13491Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 13492Family b.36.1.1: PDZ domain [50157] (7 proteins)
  6. 13500Protein Neuronal nitric oxide synthase, NNOS [50166] (1 species)
  7. 13501Species Rat (Rattus norvegicus) [TaxId:10116] [50167] (3 PDB entries)
  8. 13504Domain d1b8qa_: 1b8q A: [24781]

Details for d1b8qa_

PDB Entry: 1b8q (more details)

PDB Description: solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide

SCOP Domain Sequences for d1b8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8qa_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus)}
gshmiepnvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiila
vndrplvdlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqpl
gpptkav

SCOP Domain Coordinates for d1b8qa_:

Click to download the PDB-style file with coordinates for d1b8qa_.
(The format of our PDB-style files is described here.)

Timeline for d1b8qa_: