Lineage for d3muz14 (3muz 1:626-730)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768158Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1768159Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1768173Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 1768295Domain d3muz14: 3muz 1:626-730 [247781]
    Other proteins in same PDB: d3muz11, d3muz13, d3muz15, d3muz21, d3muz23, d3muz25, d3muz31, d3muz33, d3muz35, d3muz41, d3muz43, d3muz45
    automated match to d1jz8a2
    complexed with dms, ipt, mg, na

Details for d3muz14

PDB Entry: 3muz (more details), 1.9 Å

PDB Description: e.coli (lacz) beta-galactosidase (r599a) in complex with iptg
PDB Compounds: (1:) beta-galactosidase

SCOPe Domain Sequences for d3muz14:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muz14 b.1.4.1 (1:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3muz14:

Click to download the PDB-style file with coordinates for d3muz14.
(The format of our PDB-style files is described here.)

Timeline for d3muz14: