Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d3muy43: 3muy 4:334-625 [247775] Other proteins in same PDB: d3muy11, d3muy12, d3muy14, d3muy15, d3muy21, d3muy22, d3muy24, d3muy25, d3muy31, d3muy32, d3muy34, d3muy35, d3muy41, d3muy42, d3muy44, d3muy45 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy43:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy43 c.1.8.0 (4:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndaqfcmnglvfadrtphpalteakhqqq
Timeline for d3muy43:
View in 3D Domains from same chain: (mouse over for more information) d3muy41, d3muy42, d3muy44, d3muy45 |