Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (5 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d3muy25: 3muy 2:731-1023 [247767] Other proteins in same PDB: d3muy11, d3muy12, d3muy13, d3muy14, d3muy21, d3muy22, d3muy23, d3muy24, d3muy31, d3muy32, d3muy33, d3muy34, d3muy41, d3muy42, d3muy43, d3muy44 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3muy (more details), 2.5 Å
SCOPe Domain Sequences for d3muy25:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muy25 b.30.5.0 (2:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3muy25:
View in 3D Domains from same chain: (mouse over for more information) d3muy21, d3muy22, d3muy23, d3muy24 |