Lineage for d3muy25 (3muy 2:731-1023)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782802Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 1782803Protein automated matches [226849] (5 species)
    not a true protein
  7. 1782813Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 1782875Domain d3muy25: 3muy 2:731-1023 [247767]
    Other proteins in same PDB: d3muy11, d3muy12, d3muy13, d3muy14, d3muy21, d3muy22, d3muy23, d3muy24, d3muy31, d3muy32, d3muy33, d3muy34, d3muy41, d3muy42, d3muy43, d3muy44
    automated match to d1jz8a4
    complexed with dms, mg, na

Details for d3muy25

PDB Entry: 3muy (more details), 2.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (r599a)
PDB Compounds: (2:) Beta-D-galactosidase

SCOPe Domain Sequences for d3muy25:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muy25 b.30.5.0 (2:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3muy25:

Click to download the PDB-style file with coordinates for d3muy25.
(The format of our PDB-style files is described here.)

Timeline for d3muy25: