Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Aeromonas punctata [TaxId:648] [232631] (8 PDB entries) |
Domain d3muoa2: 3muo A:418-690 [247757] Other proteins in same PDB: d3muoa1 automated match to d3iula2 complexed with gol, so4, suc, zpr |
PDB Entry: 3muo (more details), 1.95 Å
SCOPe Domain Sequences for d3muoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muoa2 c.69.1.0 (A:418-690) automated matches {Aeromonas punctata [TaxId: 648]} edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh gagtpvaklieqsadiyaftlyemgyrelprqp
Timeline for d3muoa2: