Lineage for d3muoa1 (3muo A:7-417)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809416Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2809484Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 2809485Protein automated matches [226853] (5 species)
    not a true protein
  7. 2809486Species Aeromonas punctata [TaxId:648] [232629] (8 PDB entries)
  8. 2809487Domain d3muoa1: 3muo A:7-417 [247756]
    Other proteins in same PDB: d3muoa2
    automated match to d3iula1
    complexed with gol, so4, zpr

Details for d3muoa1

PDB Entry: 3muo (more details), 1.95 Å

PDB Description: appep_pepclose+pp closed state
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3muoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3muoa1 b.69.7.0 (A:7-417) automated matches {Aeromonas punctata [TaxId: 648]}
lhypvtrqgeqvdhyfgqavadpyrwleddrspeteawvkaqnavtqdylaqipyraaik
eklaaswnyakegapfwwgryhyffkndglqnqnvlwrqqegkpaevfldpntlspdgtt
aldqlsfsrdgrilayslslagsdwreihlmdveskqpletplkdvkfsgiswlgnegff
yssydkpdgselsartdqhkvyfhrlgtaqeddrlvfgaipaqhhryvgatvtedqrfll
isaanstsgnrlyvkdlsqenaplltvqgdldadvslvdnkgstlylltnrdapnrrlvt
vdaanpgpahwrdliperqqvltvhsgsgylfaeymvdatarveqfdyegkrvrevalpg
lgsvsgfngywwdpalyfgfenyaqpptlyrfepksgaislyrasaapfkp

SCOPe Domain Coordinates for d3muoa1:

Click to download the PDB-style file with coordinates for d3muoa1.
(The format of our PDB-style files is described here.)

Timeline for d3muoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3muoa2