SCOPe 2.08: Domain d3mszb1: 3msz B:1-86

Lineage for d3mszb1 (3msz B:1-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [232833] (3 PDB entries)

8. Domain d3mszb1: 3msz B:1-86 [247751]
   Other proteins in same PDB: d3msza2, d3mszb2
   automated match to d3lgca_
   complexed with cac, gol, gsh

Details for d3mszb1

PDB Entry: 3msz, 2.05 Å

PDB Description: Crystal Structure of Glutaredoxin 1 from Francisella tularensis Complexed with Cacodylate

PDB Compounds: (B:) Glutaredoxin 1

SCOPe Domain Sequences for d3mszb1:

Sequence; same for both SEQRES and ATOM records:

>d3mszb1 c.47.1.0 (B:1-86) automated matches {Francisella tularensis [TaxId: 177416]}
mkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistvp
qifiddehiggftelkanadkilnkk

Timeline for d3mszb1:

• d3mszb1 first appeared in SCOPe 2.04, called d3mszb_
  
• d3mszb1 appears in SCOPe 2.07