![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (74 species) not a true protein |
![]() | Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries) |
![]() | Domain d3msyf2: 3msy F:148-381 [247749] Other proteins in same PDB: d3msya1, d3msyb1, d3msyc1, d3msyd1, d3msye1, d3msyf1 automated match to d3bjsa2 |
PDB Entry: 3msy (more details), 2.5 Å
SCOPe Domain Sequences for d3msyf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msyf2 c.1.11.0 (F:148-381) automated matches {Marine actinobacterium [TaxId: 312284]} yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid
Timeline for d3msyf2: