Lineage for d3msyf2 (3msy F:148-381)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824157Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)
  8. 1824175Domain d3msyf2: 3msy F:148-381 [247749]
    Other proteins in same PDB: d3msya1, d3msyb1, d3msyc1, d3msyd1, d3msye1, d3msyf1
    automated match to d3bjsa2

Details for d3msyf2

PDB Entry: 3msy (more details), 2.5 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium
PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3msyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3msyf2 c.1.11.0 (F:148-381) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid

SCOPe Domain Coordinates for d3msyf2:

Click to download the PDB-style file with coordinates for d3msyf2.
(The format of our PDB-style files is described here.)

Timeline for d3msyf2: