Lineage for d3msye1 (3msy E:28-147)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905582Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries)
  8. 1905599Domain d3msye1: 3msy E:28-147 [247746]
    Other proteins in same PDB: d3msya2, d3msyb2, d3msyc2, d3msyd2, d3msye2, d3msyf2
    automated match to d3bjsa1

Details for d3msye1

PDB Entry: 3msy (more details), 2.5 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3msye1:

Sequence, based on SEQRES records: (download)

>d3msye1 d.54.1.0 (E:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidriiheelap
tligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

Sequence, based on observed residues (ATOM records): (download)

>d3msye1 d.54.1.0 (E:28-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ipmvaplarefrgsthrativtrvhtdagiigeaytgdehetmfdidriiheelaptlig
qdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

SCOPe Domain Coordinates for d3msye1:

Click to download the PDB-style file with coordinates for d3msye1.
(The format of our PDB-style files is described here.)

Timeline for d3msye1: