SCOPe 2.05: Domain d3msyc2: 3msy C:148-385

Lineage for d3msyc2 (3msy C:148-385)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)

8. Domain d3msyc2: 3msy C:148-385 [247743]
   Other proteins in same PDB: d3msya1, d3msyb1, d3msyc1, d3msyd1, d3msye1, d3msyf1
   automated match to d3bjsa2

Details for d3msyc2

PDB Entry: 3msy, 2.5 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3msyc2:

Sequence; same for both SEQRES and ATOM records:

>d3msyc2 c.1.11.0 (C:148-385) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv

Timeline for d3msyc2:

• d3msyc2 first appeared in SCOPe 2.04
  
• d3msyc2 appears in SCOPe 2.06
  
• d3msyc2 appears in the current release, SCOPe 2.08