SCOPe 2.06: Domain d3mjgb_: 3mjg B:

Lineage for d3mjgb_ (3mjg B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)

8. Domain d3mjgb_: 3mjg B: [247728]
   automated match to d1pdga_
   complexed with nag, ndg

Details for d3mjgb_

PDB Entry: 3mjg, 2.3 Å

PDB Description: the structure of a platelet derived growth factor receptor complex

PDB Compounds: (B:) Platelet-derived growth factor subunit B

SCOPe Domain Sequences for d3mjgb_:

Sequence; same for both SEQRES and ATOM records:

>d3mjgb_ g.17.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgsltiaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcr
ptqvqlrpvqvrkieivrkkpifkkatvtledhlackcetv

Timeline for d3mjgb_:

• d3mjgb_ first appeared in SCOPe 2.04
  
• d3mjgb_ appears in SCOPe 2.05
  
• d3mjgb_ appears in SCOPe 2.07
  
• d3mjgb_ appears in the current release, SCOPe 2.08