SCOPe 2.06: Domain d3miwc_: 3miw C:

Lineage for d3miwc_ (3miw C:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families)
   not a true superfamily

5. Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)

6. Protein automated matches [254616] (4 species)
   not a true protein

7. Species Human rotavirus g4 [TaxId:10960] [255969] (1 PDB entry)

8. Domain d3miwc_: 3miw C: [247716]
   automated match to d1g1ja_
   complexed with edo

Details for d3miwc_

PDB Entry: 3miw, 2.5 Å

PDB Description: Crystal Structure of Rotavirus NSP4

PDB Compounds: (C:) Non-structural glycoprotein 4

SCOPe Domain Sequences for d3miwc_:

Sequence; same for both SEQRES and ATOM records:

>d3miwc_ h.1.13.1 (C:) automated matches {Human rotavirus g4 [TaxId: 10960]}
mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpv

Timeline for d3miwc_:

• d3miwc_ first appeared in SCOPe 2.04
  
• d3miwc_ appears in SCOPe 2.05
  
• d3miwc_ appears in SCOPe 2.07
  
• d3miwc_ appears in the current release, SCOPe 2.08