Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain |
Protein DNA polymerase lambda [102943] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102944] (26 PDB entries) |
Domain d3mghc3: 3mgh C:386-575 [247699] Other proteins in same PDB: d3mgha1, d3mgha2, d3mghc1, d3mghc2 automated match to d1rzta3 protein/DNA complex; complexed with na; mutant |
PDB Entry: 3mgh (more details), 2.4 Å
SCOPe Domain Sequences for d3mghc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mghc3 d.218.1.2 (C:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs rlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefacallyftgsa hfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllglpyrep aerdw
Timeline for d3mghc3: