SCOPe 2.05: Domain d3mghc3: 3mgh C:386-575

Lineage for d3mghc3 (3mgh C:386-575)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
   insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain

6. Protein DNA polymerase lambda [102943] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102944] (26 PDB entries)

8. Domain d3mghc3: 3mgh C:386-575 [247699]
   Other proteins in same PDB: d3mgha1, d3mgha2, d3mghc1, d3mghc2
   automated match to d1rzta3
   protein/DNA complex; complexed with na; mutant

Details for d3mghc3

PDB Entry: 3mgh, 2.4 Å

PDB Description: binary complex of a dna polymerase lambda loop mutant

PDB Compounds: (C:) DNA polymerase lambda

SCOPe Domain Sequences for d3mghc3:

Sequence; same for both SEQRES and ATOM records:

>d3mghc3 d.218.1.2 (C:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefacallyftgsa
hfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllglpyrep
aerdw

Timeline for d3mghc3:

• d3mghc3 first appeared in SCOPe 2.04
  
• d3mghc3 appears in SCOPe 2.06
  
• d3mghc3 appears in the current release, SCOPe 2.08