SCOPe 2.05: Domain d3mg4i_: 3mg4 I:

Lineage for d3mg4i_ (3mg4 I:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3mg4i_: 3mg4 I: [247676]
   Other proteins in same PDB: d3mg4g_, d3mg4u_
   automated match to d4eu2j_
   complexed with lxt, mes, mg

Details for d3mg4i_

PDB Entry: 3mg4, 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1

PDB Compounds: (I:) Proteasome component PUP3

SCOPe Domain Sequences for d3mg4i_:

Sequence; same for both SEQRES and ATOM records:

>d3mg4i_ d.153.1.4 (I:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d3mg4i_:

• d3mg4i_ first appeared in SCOPe 2.04
  
• d3mg4i_ appears in SCOPe 2.06
  
• d3mg4i_ appears in the current release, SCOPe 2.08