Lineage for d3mg4g_ (3mg4 G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552958Domain d3mg4g_: 3mg4 G: [247674]
    Other proteins in same PDB: d3mg41_, d3mg42_, d3mg4a_, d3mg4b_, d3mg4c_, d3mg4d_, d3mg4e_, d3mg4f_, d3mg4h_, d3mg4i_, d3mg4j_, d3mg4k_, d3mg4l_, d3mg4m_, d3mg4n_, d3mg4o_, d3mg4p_, d3mg4q_, d3mg4r_, d3mg4s_, d3mg4t_, d3mg4v_, d3mg4w_, d3mg4x_, d3mg4y_, d3mg4z_
    automated match to d1rypa_
    complexed with lxt, mes, mg

Details for d3mg4g_

PDB Entry: 3mg4 (more details), 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3mg4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg4g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3mg4g_:

Click to download the PDB-style file with coordinates for d3mg4g_.
(The format of our PDB-style files is described here.)

Timeline for d3mg4g_: