Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (98 species) not a true protein |
Species Giardia lamblia [TaxId:184922] [255966] (1 PDB entry) |
Domain d3meba_: 3meb A: [247661] automated match to d2csta_ complexed with edo, plp, so4 |
PDB Entry: 3meb (more details), 1.9 Å
SCOPe Domain Sequences for d3meba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3meba_ c.67.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]} msvfsgfpasppdailnltvlynadtnpkkvnlgvgayrdesgkpwilpavkeaeaiiss dlskynkeyppvagfplfleaaqflmfgkdskaaqegriascqslsgtgslhigfeflhl wmpkaefympsttwpnhygiydkvfnklkvpykeytylrkdgeleidfsntkkdiqsape ksiflfhacahnpsgidfteaqwkellpimkekkhiaffdsayqgfatgsfeadafavrm fvdagvevlvaqsfsknfglygerigclhvvhagvegsveknkalsaamvsgmtlqirkt wsmsaihgayivqvivhdkrllqmfydnvkemsarihrmrsllhaslakrktpgpgskgt wdhiltaigmftftgltpehvdylkekwsiylvkaggrmsmcgltesncdyvaeaihdav tklpfk
Timeline for d3meba_: