Lineage for d3meba_ (3meb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897191Species Giardia lamblia [TaxId:184922] [255966] (1 PDB entry)
  8. 2897192Domain d3meba_: 3meb A: [247661]
    automated match to d2csta_
    complexed with edo, plp, so4

Details for d3meba_

PDB Entry: 3meb (more details), 1.9 Å

PDB Description: structure of cytoplasmic aspartate aminotransferase from giardia lamblia
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d3meba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3meba_ c.67.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]}
msvfsgfpasppdailnltvlynadtnpkkvnlgvgayrdesgkpwilpavkeaeaiiss
dlskynkeyppvagfplfleaaqflmfgkdskaaqegriascqslsgtgslhigfeflhl
wmpkaefympsttwpnhygiydkvfnklkvpykeytylrkdgeleidfsntkkdiqsape
ksiflfhacahnpsgidfteaqwkellpimkekkhiaffdsayqgfatgsfeadafavrm
fvdagvevlvaqsfsknfglygerigclhvvhagvegsveknkalsaamvsgmtlqirkt
wsmsaihgayivqvivhdkrllqmfydnvkemsarihrmrsllhaslakrktpgpgskgt
wdhiltaigmftftgltpehvdylkekwsiylvkaggrmsmcgltesncdyvaeaihdav
tklpfk

SCOPe Domain Coordinates for d3meba_:

Click to download the PDB-style file with coordinates for d3meba_.
(The format of our PDB-style files is described here.)

Timeline for d3meba_: