Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries) |
Domain d3mdjc2: 3mdj C:255-529 [247653] Other proteins in same PDB: d3mdja1, d3mdja3, d3mdja4, d3mdjb1, d3mdjb3, d3mdjb4, d3mdjc1, d3mdjc3, d3mdjc4 automated match to d2yd0a2 complexed with bes, nag, zn |
PDB Entry: 3mdj (more details), 2.95 Å
SCOPe Domain Sequences for d3mdjc2:
Sequence, based on SEQRES records: (download)
>d3mdjc2 d.92.1.0 (C:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]} esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm dgfcsrsqhssssshwhqervdvktmmntwtlqrg
>d3mdjc2 d.92.1.0 (C:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]} esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnssddvsydkgacilnmlrey lsadafksgivqylqkhsykntknedlwdsmasivdvktmmntwtlqrg
Timeline for d3mdjc2: