SCOPe 2.04: Domain d3mdjb2: 3mdj B:255-529

Lineage for d3mdjb2 (3mdj B:255-529)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)

8. Domain d3mdjb2: 3mdj B:255-529 [247649]
   Other proteins in same PDB: d3mdja1, d3mdja3, d3mdja4, d3mdjb1, d3mdjb3, d3mdjb4, d3mdjc1, d3mdjc3, d3mdjc4
   automated match to d2yd0a2
   complexed with bes, nag, zn

Details for d3mdjb2

PDB Entry: 3mdj, 2.95 Å

PDB Description: er aminopeptidase, erap1, bound to the zinc aminopeptidase inhibitor, bestatin

PDB Compounds: (B:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3mdjb2:

Sequence, based on SEQRES records:

>d3mdjb2 d.92.1.0 (B:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm
dgfcsrsqhssssshwhqervdvktmmntwtlqrg

Sequence, based on observed residues (ATOM records):

>d3mdjb2 d.92.1.0 (B:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklditmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnssddvsydkgacilnmlrey
lsadafksgivqylqkhsykntknedlwdsmasivdvktmmntwtlqrg

Timeline for d3mdjb2:

• d3mdjb2 is new in SCOPe 2.04-stable
  
• d3mdjb2 appears in SCOPe 2.05
  
• d3mdjb2 appears in the current release, SCOPe 2.08