SCOPe 2.06: Domain d3mdca1: 3mdc A:254-328

Lineage for d3mdca1 (3mdc A:254-328)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)

8. Domain d3mdca1: 3mdc A:254-328 [247641]
   Other proteins in same PDB: d3mdca2, d3mdca3
   automated match to d1rzta1
   protein/DNA complex; complexed with gtf, mg, na

Details for d3mdca1

PDB Entry: 3mdc, 2 Å

PDB Description: dna polymerase lambda in complex with dfdctp

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3mdca1:

Sequence; same for both SEQRES and ATOM records:

>d3mdca1 a.60.6.1 (A:254-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
lhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaeki
ieilesghlrkldhi

Timeline for d3mdca1:

• d3mdca1 first appeared in SCOPe 2.04
  
• d3mdca1 appears in SCOPe 2.05
  
• d3mdca1 appears in SCOPe 2.07
  
• d3mdca1 appears in the current release, SCOPe 2.08