SCOPe 2.05: Domain d3mcab2: 3mca B:272-379

Lineage for d3mcab2 (3mca B:272-379)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.0: automated matches [254304] (1 protein)
   not a true family

6. Protein automated matches [254705] (2 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255961] (1 PDB entry)

8. Domain d3mcab2: 3mca B:272-379 [247638]
   Other proteins in same PDB: d3mcab1
   automated match to d2vgnb3

Details for d3mcab2

PDB Entry: 3mca, 2.74 Å

PDB Description: Structure of the Dom34-Hbs1 Complex and implications for its role in No-Go decay

PDB Compounds: (B:) Protein dom34

SCOPe Domain Sequences for d3mcab2:

Sequence; same for both SEQRES and ATOM records:

>d3mcab2 d.79.3.0 (B:272-379) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vqeirvlnkfydvmneddrkawygpnhvlkafelgaigellisdslfrssdiatrkkwvs
lvegvkeincpvyifsslhesgkqldllsgiaailtypvdeedisede

Timeline for d3mcab2:

• d3mcab2 first appeared in SCOPe 2.04
  
• d3mcab2 appears in SCOPe 2.06
  
• d3mcab2 appears in the current release, SCOPe 2.08