SCOPe 2.06: Domain d3mbqc_: 3mbq C:

Lineage for d3mbqc_ (3mbq C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [255959] (2 PDB entries)

8. Domain d3mbqc_: 3mbq C: [247635]
   automated match to d1sixa_
   complexed with edo, gol, so4

Details for d3mbqc_

PDB Entry: 3mbq, 2.1 Å

PDB Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Brucella melitensis, orthorhombic crystal form

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3mbqc_:

Sequence, based on SEQRES records:

>d3mbqc_ b.85.4.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
apviqpkieerakisetargaggf

Sequence, based on observed residues (ATOM records):

>d3mbqc_ b.85.4.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
aptlgiirlehakgldlpayetagsagmdlraavaedrqivllpgrrtlvptglileipq
gyevqirprsglafkngitclntpgtidsdyrgevkvllinlgdddfriergmriaqavf
apviqpkieerakigaggf

Timeline for d3mbqc_:

• d3mbqc_ first appeared in SCOPe 2.04
  
• d3mbqc_ appears in SCOPe 2.05
  
• d3mbqc_ appears in SCOPe 2.07
  
• d3mbqc_ appears in the current release, SCOPe 2.08