Lineage for d1ykfd1 (1ykf D:1-139,D:314-352)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797474Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 797673Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 797687Species Thermoanaerobacter brockii [TaxId:29323] [50144] (4 PDB entries)
  8. 797695Domain d1ykfd1: 1ykf D:1-139,D:314-352 [24760]
    Other proteins in same PDB: d1ykfa2, d1ykfb2, d1ykfc2, d1ykfd2
    complexed with nap, zn

Details for d1ykfd1

PDB Entry: 1ykf (more details), 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1ykfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykfd1 b.35.1.2 (D:1-139,D:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila

SCOP Domain Coordinates for d1ykfd1:

Click to download the PDB-style file with coordinates for d1ykfd1.
(The format of our PDB-style files is described here.)

Timeline for d1ykfd1: