SCOPe 2.08: Domain d3m1bg2: 3m1b G:177-267

Lineage for d3m1bg2 (3m1b G:177-267)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3m1bg2: 3m1b G:177-267 [247574]
   Other proteins in same PDB: d3m1ba1, d3m1bb_, d3m1bc1, d3m1bd_, d3m1be1, d3m1bf_, d3m1bg1, d3m1bh_
   automated match to d3frua1

Details for d3m1bg2

PDB Entry: 3m1b, 3.1 Å

PDB Description: crystal structure of human fcrn with a dimeric peptide inhibitor

PDB Compounds: (G:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d3m1bg2:

Sequence; same for both SEQRES and ATOM records:

>d3m1bg2 b.1.1.2 (G:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

Timeline for d3m1bg2:

• d3m1bg2 first appeared in SCOPe 2.04
  
• d3m1bg2 appears in SCOPe 2.07