Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d3m1be2: 3m1b E:177-267 [247571] Other proteins in same PDB: d3m1ba1, d3m1bb_, d3m1bc1, d3m1bd_, d3m1be1, d3m1bf_, d3m1bg1, d3m1bh_ automated match to d3frua1 |
PDB Entry: 3m1b (more details), 3.1 Å
SCOPe Domain Sequences for d3m1be2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1be2 b.1.1.2 (E:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]} keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha sssltvksgdehhyccivqhaglaqplrvel
Timeline for d3m1be2: