Lineage for d3ly6b1 (3ly6 B:4-145)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524349Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 1524350Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 1524378Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (3 PDB entries)
    GDP-binding protein
  8. 1524387Domain d3ly6b1: 3ly6 B:4-145 [247548]
    Other proteins in same PDB: d3ly6a2, d3ly6a3, d3ly6a4, d3ly6b2, d3ly6b3, d3ly6b4, d3ly6c2, d3ly6c3, d3ly6c4
    automated match to d2q3za1
    complexed with atp

Details for d3ly6b1

PDB Entry: 3ly6 (more details), 3.14 Å

PDB Description: Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate
PDB Compounds: (B:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d3ly6b1:

Sequence, based on SEQRES records: (download)

>d3ly6b1 b.1.18.9 (B:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
gyqgssfvlghfillfnawcpa

Sequence, based on observed residues (ATOM records): (download)

>d3ly6b1 b.1.18.9 (B:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdavgdwtatvvdqqdctlslqlttpanapiglyrlsleastgy
qgssfvlghfillfnawcpa

SCOPe Domain Coordinates for d3ly6b1:

Click to download the PDB-style file with coordinates for d3ly6b1.
(The format of our PDB-style files is described here.)

Timeline for d3ly6b1: