Lineage for d3lxca1 (3lxc A:32-323)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818560Protein Melibiase [75064] (4 species)
  7. 1818564Species Human (Homo sapiens) [TaxId:9606] [102062] (17 PDB entries)
    alpha-galactosidase A
  8. 1818577Domain d3lxca1: 3lxc A:32-323 [247537]
    Other proteins in same PDB: d3lxca2, d3lxcb2
    automated match to d3lx9a1
    complexed with gol, nag

Details for d3lxca1

PDB Entry: 3lxc (more details), 2.35 Å

PDB Description: interconversion of human lysosomal enzyme specificities
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3lxca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxca1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscswpaymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

SCOPe Domain Coordinates for d3lxca1:

Click to download the PDB-style file with coordinates for d3lxca1.
(The format of our PDB-style files is described here.)

Timeline for d3lxca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lxca2