Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (5 species) not a true protein |
Species Escherichia coli [TaxId:83334] [255939] (3 PDB entries) |
Domain d3lq4b3: 3lq4 B:701-886 [247507] Other proteins in same PDB: d3lq4a1, d3lq4a2, d3lq4b1, d3lq4b2 automated match to d2ieaa3 complexed with epe, mg, po4, tdp; mutant |
PDB Entry: 3lq4 (more details), 1.98 Å
SCOPe Domain Sequences for d3lq4b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lq4b3 c.48.1.0 (B:701-886) automated matches {Escherichia coli [TaxId: 83334]} mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk vnprla
Timeline for d3lq4b3: