SCOPe 2.04: Domain d3lq2a2: 3lq2 A:471-700

Lineage for d3lq2a2 (3lq2 A:471-700)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family
6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [255938] (3 PDB entries)

8. Domain d3lq2a2: 3lq2 A:471-700 [247497]
   Other proteins in same PDB: d3lq2a1, d3lq2a3, d3lq2b1, d3lq2b3
   automated match to d2ieaa1
   complexed with epe, mg, po4, tdp; mutant

Details for d3lq2a2

PDB Entry: 3lq2, 1.96 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 e235a mutant with low tdp concentration

PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lq2a2:

Sequence, based on SEQRES records:

>d3lq2a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records):

>d3lq2a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

Timeline for d3lq2a2:

• d3lq2a2 is new in SCOPe 2.04-stable
  
• d3lq2a2 appears in SCOPe 2.05
  
• d3lq2a2 appears in the current release, SCOPe 2.08