Lineage for d3lp8a2 (3lp8 A:102-324)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217715Species Ehrlichia chaffeensis [TaxId:205920] [255935] (1 PDB entry)
  8. 2217716Domain d3lp8a2: 3lp8 A:102-324 [247484]
    Other proteins in same PDB: d3lp8a1, d3lp8a3, d3lp8a4
    automated match to d1gsoa3
    complexed with po4, unx

Details for d3lp8a2

PDB Entry: 3lp8 (more details), 2.15 Å

PDB Description: Crystal structure of phosphoribosylamine-glycine ligase from Ehrlichia chaffeensis
PDB Compounds: (A:) Phosphoribosylamine-glycine ligase

SCOPe Domain Sequences for d3lp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lp8a2 d.142.1.0 (A:102-324) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
skgftkelcmrygiptakygyfvdtnsaykfidkhklplvvkadglaqgkgtvichthee
aynavdamlvhhkfgeagcaiiieeflegkeisfftlvdgsnpvilgvaqdyktigdnnk
gpntggmgsyskpniitqemehiiiqkiiyptikamfnmniqfrgllfagiiikknepkl
leynvrfgdpetqsilprlnsdflkllsltakgklgnesvels

SCOPe Domain Coordinates for d3lp8a2:

Click to download the PDB-style file with coordinates for d3lp8a2.
(The format of our PDB-style files is described here.)

Timeline for d3lp8a2: