Lineage for d3ld9d1 (3ld9 D:1-201)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128439Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry)
  8. 2128443Domain d3ld9d1: 3ld9 D:1-201 [247449]
    Other proteins in same PDB: d3ld9a2, d3ld9b2, d3ld9c2, d3ld9d2
    automated match to d3hjna_
    complexed with edo, so4

Details for d3ld9d1

PDB Entry: 3ld9 (more details), 2.15 Å

PDB Description: Crystal structure of thymidylate kinase from Ehrlichia chaffeensis at 2.15A resolution
PDB Compounds: (D:) thymidylate kinase

SCOPe Domain Sequences for d3ld9d1:

Sequence, based on SEQRES records: (download)

>d3ld9d1 c.37.1.0 (D:1-201) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvitdks
etydiddinfvhlevikvlqm

Sequence, based on observed residues (ATOM records): (download)

>d3ld9d1 c.37.1.0 (D:1-201) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvddmefyyrvrdgfydiakknphrchvittydiddinfvhlevikvlq
m

SCOPe Domain Coordinates for d3ld9d1:

Click to download the PDB-style file with coordinates for d3ld9d1.
(The format of our PDB-style files is described here.)

Timeline for d3ld9d1: