SCOPe 2.05: Domain d3ld9c_: 3ld9 C:

Lineage for d3ld9c_ (3ld9 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry)

8. Domain d3ld9c_: 3ld9 C: [247448]
   automated match to d3hjna_
   complexed with edo, so4

Details for d3ld9c_

PDB Entry: 3ld9, 2.15 Å

PDB Description: Crystal structure of thymidylate kinase from Ehrlichia chaffeensis at 2.15A resolution

PDB Compounds: (C:) thymidylate kinase

SCOPe Domain Sequences for d3ld9c_:

Sequence, based on SEQRES records:

>d3ld9c_ c.37.1.0 (C:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg
ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln
dlvidvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvit
dksetydiddinfvhlevikvlq

Sequence, based on observed residues (ATOM records):

>d3ld9c_ c.37.1.0 (C:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg
ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln
dlvidvypditfiidvddmefyyrvrdgfydiakknphrchvitfvhlevikvlq

Timeline for d3ld9c_:

• d3ld9c_ first appeared in SCOPe 2.04
  
• d3ld9c_ is called d3ld9c1 in SCOPe 2.06
  
• d3ld9c_ appears in the current release, SCOPe 2.08, called d3ld9c1