SCOPe 2.06: Domain d3ld9a1: 3ld9 A:1-200

Lineage for d3ld9a1 (3ld9 A:1-200)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry)

8. Domain d3ld9a1: 3ld9 A:1-200 [247446]
   Other proteins in same PDB: d3ld9a2, d3ld9b2, d3ld9c2, d3ld9d2
   automated match to d3hjna_
   complexed with edo, so4

Details for d3ld9a1

PDB Entry: 3ld9, 2.15 Å

PDB Description: Crystal structure of thymidylate kinase from Ehrlichia chaffeensis at 2.15A resolution

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3ld9a1:

Sequence, based on SEQRES records:

>d3ld9a1 c.37.1.0 (A:1-200) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvitdks
etydiddinfvhlevikvlq

Sequence, based on observed residues (ATOM records):

>d3ld9a1 c.37.1.0 (A:1-200) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvddmefyyrvrdgfydiakknphrchvitdksetydiddinfvhlevi
kvlq

Timeline for d3ld9a1:

• d3ld9a1 first appeared in SCOPe 2.04, called d3ld9a_
  
• d3ld9a1 was called d3ld9a_ in SCOPe 2.05
  
• d3ld9a1 appears in SCOPe 2.07
  
• d3ld9a1 appears in the current release, SCOPe 2.08