Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry) |
Domain d3ld9a_: 3ld9 A: [247446] automated match to d3hjna_ complexed with edo, so4 |
PDB Entry: 3ld9 (more details), 2.15 Å
SCOPe Domain Sequences for d3ld9a_:
Sequence, based on SEQRES records: (download)
>d3ld9a_ c.37.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln dlvidvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvit dksetydiddinfvhlevikvlq
>d3ld9a_ c.37.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln dlvidvypditfiidvddmefyyrvrdgfydiakknphrchvitdksetydiddinfvhl evikvlq
Timeline for d3ld9a_: