Lineage for d3ld9a_ (3ld9 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598042Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry)
  8. 1598043Domain d3ld9a_: 3ld9 A: [247446]
    automated match to d3hjna_
    complexed with edo, so4

Details for d3ld9a_

PDB Entry: 3ld9 (more details), 2.15 Å

PDB Description: Crystal structure of thymidylate kinase from Ehrlichia chaffeensis at 2.15A resolution
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3ld9a_:

Sequence, based on SEQRES records: (download)

>d3ld9a_ c.37.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg
ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln
dlvidvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvit
dksetydiddinfvhlevikvlq

Sequence, based on observed residues (ATOM records): (download)

>d3ld9a_ c.37.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
pgsmfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqg
ldslsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqln
dlvidvypditfiidvddmefyyrvrdgfydiakknphrchvitdksetydiddinfvhl
evikvlq

SCOPe Domain Coordinates for d3ld9a_:

Click to download the PDB-style file with coordinates for d3ld9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ld9a_: