SCOPe 2.05: Domain d3l8aa_: 3l8a A:

Lineage for d3l8aa_ (3l8a A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [255923] (2 PDB entries)

8. Domain d3l8aa_: 3l8a A: [247415]
   automated match to d3b1da_
   complexed with plp

Details for d3l8aa_

PDB Entry: 3l8a, 1.54 Å

PDB Description: crystal structure of metc from streptococcus mutans

PDB Compounds: (A:) Putative aminotransferase, probable beta-cystathionase

SCOPe Domain Sequences for d3l8aa_:

Sequence; same for both SEQRES and ATOM records:

>d3l8aa_ c.67.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
ydfttrpdrlnqftykwktsennpellqmwvadmdflpvpeikeaiinygrehifgynyf
nddlyqavidwerkehdyavvkedilfidgvvpaisialqafsekgdavlinspvyypfa
rtirlndhrlvenslqiingrfeidfeqlekdiidnnvkiyllcsphnpggrvwdnddli
kiaelckkhgvilvsdeihqdlalfgnthhslntldasykdftiilssatktfniagtkn
sfaiiqneslrrkfqyrqlannqhevptvgmiatqaafqygkpwleelktviegniklvi
keleaktkikvmepegtylvwldfsayaiaqpqlseklqneakvvlndgahfgkegkyfa
rlnvatpkntvqealsriisvf

Timeline for d3l8aa_:

• d3l8aa_ first appeared in SCOPe 2.04
  
• d3l8aa_ appears in SCOPe 2.06
  
• d3l8aa_ appears in the current release, SCOPe 2.08