Lineage for d3l73u_ (3l73 U:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699300Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699301Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 1699302Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1699332Protein automated matches [190042] (3 species)
    not a true protein
  7. 1699333Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 1699345Domain d3l73u_: 3l73 U: [247410]
    Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73f_, d3l73g_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73s_, d3l73t_, d3l73w_
    automated match to d3l75h_
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73u_

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (U:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l73u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk

SCOPe Domain Coordinates for d3l73u_:

Click to download the PDB-style file with coordinates for d3l73u_.
(The format of our PDB-style files is described here.)

Timeline for d3l73u_: