Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein automated matches [190325] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries) |
Domain d3l73s_: 3l73 S: [247408] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73t_, d3l73u_, d3l73w_ automated match to d1l0lf_ complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73s_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
Timeline for d3l73s_:
View in 3D Domains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73t_, d3l73u_, d3l73w_ |