Lineage for d3l73p2 (3l73 P:262-380)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633244Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2633245Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2633314Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 2633315Protein automated matches [254431] (4 species)
    not a true protein
  7. 2633321Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries)
  8. 2633325Domain d3l73p2: 3l73 P:262-380 [247405]
    Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
    automated match to d3l75c2
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73p2

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l73p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73p2 f.32.1.0 (P:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l73p2:

Click to download the PDB-style file with coordinates for d3l73p2.
(The format of our PDB-style files is described here.)

Timeline for d3l73p2: