Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries) |
Domain d3l73p1: 3l73 P:2-261 [247404] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ automated match to d3l75p1 complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73p1 f.21.1.2 (P:2-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl tlalfspnllgdpenftpan
Timeline for d3l73p1:
View in 3D Domains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ |