SCOPe 2.04: Domain d3l73p1: 3l73 P:2-261

Lineage for d3l73p1 (3l73 P:2-261)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries)

8. Domain d3l73p1: 3l73 P:2-261 [247404]
   Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c2, d3l73d1, d3l73d2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p2, d3l73q1, d3l73q2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
   automated match to d3l75p1
   complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73p1

PDB Entry: 3l73, 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor

PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l73p1:

Sequence; same for both SEQRES and ATOM records:

>d3l73p1 f.21.1.2 (P:2-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

Timeline for d3l73p1:

• d3l73p1 is new in SCOPe 2.04-stable
  
• d3l73p1 appears in SCOPe 2.05
  
• d3l73p1 appears in the current release, SCOPe 2.08