Lineage for d3l73o2 (3l73 O:236-439)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611366Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 2611367Protein automated matches [232766] (2 species)
    not a true protein
  7. 2611368Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 2611415Domain d3l73o2: 3l73 O:236-439 [247403]
    Other proteins in same PDB: d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
    automated match to d3l71b2
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73o2

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (O:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l73o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73o2 d.185.1.0 (O:236-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

SCOPe Domain Coordinates for d3l73o2:

Click to download the PDB-style file with coordinates for d3l73o2.
(The format of our PDB-style files is described here.)

Timeline for d3l73o2: